PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn012091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB
Protein Properties Length: 480aa    MW: 54542.6 Da    PI: 9.5947
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn012091genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.4e-1880125147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
       Achn012091  80 RGHWRPAEDEKLRRLVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 125
                      899*****************************.***********996 PP

2Myb_DNA-binding55.51.3e-17132175146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l  a++ +G++ W++I+r ++ gRt++ +k++w+ 
       Achn012091 132 RRPFSEEEEERLFAAHRIHGNK-WALISRLFP-GRTDNAVKNHWHV 175
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.06675126IPR017930Myb domain
SuperFamilySSF466891.42E-2879173IPR009057Homeodomain-like
SMARTSM007174.9E-1579128IPR001005SANT/Myb domain
PfamPF002494.5E-1780125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-2781133IPR009057Homeodomain-like
CDDcd001671.37E-1383124No hitNo description
PROSITE profilePS5129426.928127181IPR017930Myb domain
SMARTSM007172.1E-15131179IPR001005SANT/Myb domain
PfamPF002492.0E-14132174IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-20134180IPR009057Homeodomain-like
CDDcd001672.01E-11134174No hitNo description
Gene3DG3DSA:2.60.40.4201.2E-31383478IPR008972Cupredoxin
PROSITE profilePS5148536.062384479IPR003245Phytocyanin domain
CDDcd110131.70E-53384478No hitNo description
SuperFamilySSF495032.06E-33384478IPR008972Cupredoxin
PfamPF022983.2E-25396472IPR003245Phytocyanin domain
ProDomPD0031222.0E-23414478IPR003245Phytocyanin domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0009055Molecular Functionelectron carrier activity
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MDGLPIFMLM LYSHGINFIK CFWMTVNFSW TENSIATDFS LSLLYFDVRE NLLSHQQRRR  60
LLSMDETGGG SSDDARTCPR GHWRPAEDEK LRRLVEQYGP QNWNSIAEKL QGRSGKSCRL  120
RWFNQLDPRI NRRPFSEEEE ERLFAAHRIH GNKWALISRL FPGRTDNAVK NHWHVIMARK  180
QREQSKICGK RNYQEAISFG PKISKTQENY SLKSQFESGR LFGFQAPIQD RIYTLSPSSP  240
SPSWNFTRPI SSATKNSSSV DLFGKEERDC FNSSSNSLDR PFSRYYLNSS FECSKLGDGN  300
ATHGLIKRDL VRFGGNSHPF EVMRESVREN MDEQNGDHEA MKKKNIPFID FLEMSLGRGS  360
ARTVMVIAVI LLCLLIHTVP SHGATYTVGG PGGWTFNLNN WPKGKSFNAG DVLVFNYDPS  420
YHNVVAVDRG GYSKCTTPAS AKVYTTGKDR IRLVRGQNYF ICNFSGHCES GMKIAINAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cbp_A3e-46384478195CUCUMBER BASIC PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278632.21e-108PREDICTED: trichome differentiation protein GL1
TrEMBLE0CQL81e-108E0CQL8_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g15260.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-64myb domain protein 52